PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15399A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 1532aa    MW: 167567 Da    PI: 7.5787
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15399AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.71.5e-09725767347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +WT+eE e + +  +++G++ +++I++ +  ++t  +c+++++k+
  Oropetium_20150105_15399A 725 PWTQEEKEMFMEMLAKFGKD-FSKISSFLA-HKTTADCVEFYYKH 767
                                8*****************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.89E-15709771IPR009057Homeodomain-like
PROSITE profilePS5129315.394721772IPR017884SANT domain
SMARTSM007171.0E-10722770IPR001005SANT/Myb domain
PfamPF002491.8E-7724767IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-8724770IPR009057Homeodomain-like
PROSITE profilePS5129311.897928979IPR017884SANT domain
SMARTSM007171.6E-5929977IPR001005SANT/Myb domain
SuperFamilySSF466892.18E-8932979IPR009057Homeodomain-like
CDDcd001674.25E-4933971No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1532 aa     Download sequence    Send to blast
CSQDRRTEEL RSWLRLAYVT PGGGRSWIQA PQERRRRRRG CRRRHRIGGT ICYYRQGGGA  60
YDRSYPDEMP PGYPPSRSDR YWMDDEGGGY KGFSRCGGGR RDGRDMRGGS YRRSPFRSYG  120
SDFSRNHQEQ PPPPPPRRSS LRSVAVPICY DSPGNRVDRG DRDSLPRVTP WRRRESRSEV  180
AGGHASSGQS TRPAASEKEV SPHPPSLSSP REAEEEAPRK KARLGWGQGL AKYEKQKVHG  240
PTDPAEAVAD GSLSKGSFSC TCGMRIAGCC ATTCTCAPED KSCALAANTV RKSAQDAPGS  300
DDQACNNEFP IKIDQLGGDP IDSLASLLSK FLQHDSCAGD SKDPTSTSKL LLLKESISKE  360
IEKTELEIDS LEGELKCVTT EAGTAPEDSP TGVTYTENVS HSTVASKVPG NLKICAKSHV  420
EEPGEVSPCP KMPVVQDANS KDAEMMEIET APVQNAKTAS SEESAACPGV TEAHARTAAA  480
DGPLKASARA KPHINVDIET LEASSCHIDT NSVKPDVLPG RQCLYPNHKY NLLSSLKSSN  540
HDIAKVANEL VFKHMPGDTP QPNLLASSQF STYSKNESVI KERLVLHKNR LRFKEQALTF  600
KFRALRYLWK EDVRLLCARK QRSKSSKRID QNSRTSHIGS QRQRSTNRSR LAMPAGNSSI  660
FPTPEISDVA NKLFSEFHIK RCRNYLKMPA LIIDEKEKEC LRFVSKNGLV EDPVAVEKER  720
VLINPWTQEE KEMFMEMLAK FGKDFSKISS FLAHKTTADC VEFYYKHHKS ESFREVKKLL  780
DQRQQQPSSN FLGAKSGKKW NREADAVSLD ILGVASAVAA QGLEYEKKAV KISTKSLIRN  840
GSNVSFAARK SNRECLDNIS LHERESVAAD VLAGICGTLS PEGMSSCITS SADPGQKISI  900
TGIEHILTPE IDKSFDEEDT IPDQECEVDP VDWNDDEKSI FVDAMNNYGK DFARISSCVK  960
SKSYEQCKVF FSKARKSLGL DLIHHGTADV TMLTSDTNGG RSDTDEACAA EMDSAICSTQ  1020
LFAKTEMDVC PTKSAIQGPN SCIISKQTEG DVSKGCDVSD VKTESEDKAD QTCSVDDHKR  1080
FSEVTHEPTC GSIDINCPET TEKLEGEDDT VDQRNINGCS TVSSSKEQAV LVNSETRMDG  1140
GSHHANALVK AGKFGPPASV VAESGIKENV HFSKMTDASS INAVSTSSYQ HSMTGDKPPS  1200
KPKPLVTPLT PKDLMPVQFS SVLPDPTSIR FEGIASITTS NFEDTGNMNN YPALKDQSQS  1260
GNQNGTLFRN IDGYSSHHLT TESPIVSERN ASSAVSTSHT DRFTITKFQN GRSSSLDLPN  1320
TTDGIHWDRK HNEVSDVSFR PCSRNSSSEG NEQVKRPGDV KLFGQILSHQ SSSQNSASCN  1380
GTKNNPRDRV SCSSRPAVTP HLGLEDRSVR SYSHLDGCTA QPLVMAKCQA SLAGVPFYSA  1440
KSGIFSDYQQ PSMQAHQSDP KRLERFSDPQ KRNGMELISG FQQPGKGNRF GGAGILVSGV  1500
SDPVAALKAQ YGPGSKITSC DVDPWKDIGS R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D2e-16683774494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C2e-16683774494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13341RRRRRRGCR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440514.10.0hypothetical protein SORBIDRAFT_09g002290
TrEMBLC5YZ470.0C5YZ47_SORBI; Putative uncharacterized protein Sb09g002290
STRINGSb09g002290.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-81MYB family protein